PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10006489
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 403aa    MW: 43150.7 Da    PI: 7.2364
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10006489genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.22.3e-15331382556
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                  +r++r+ kNRe+A rsR+RK+a++ eLe +v++L++eN++Lk + ee++++ 
  Lus10006489 331 RRQKRMLKNRESAARSRARKQAYTTELEAEVAKLKEENQQLKRKQEEMTEMQ 382
                  79****************************************9999999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.2E-13327391IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.645329380IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.7E-14331380No hitNo description
CDDcd147072.46E-29331385No hitNo description
PfamPF001702.1E-13331383IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.44E-11331381No hitNo description
PROSITE patternPS000360334349IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MGTNWNFNNI TNDSAQPPGN NMALTRQLSS IYSLTFDEFQ SSVGGIGKDF GSMNMDELLK  60
NIWSAEENQN QNHVNMGAAE DGGILLQRQG SLTLPRTLSQ KTVDEVWKDV WKDYGSGSSG  120
VGVGDSGSGR NPQRQQTLGE ITLEEFLVRA GVVREDITTP VVAAGKVQQS NGVVGVSPFG  180
NNTTTVGYGI GFQQSNGASH GVGLSSGSNN PNYGSNSSLN VNGIIRSNQV QPQLQVHQHQ  240
HQHQHQPPQI FPKLQGNVGY GGMMGIGDPG LDNQGMAGLG GGSSPASQVS SDGIGKSNGE  300
TSSVSPSVPY PYSGGVRGRR ANTAVEKVVE RRQKRMLKNR ESAARSRARK QAYTTELEAE  360
VAKLKEENQQ LKRKQEEMTE MQKNQVSLCG METTAPSFPE PL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012071654.11e-120PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 5
SwissprotQ9M7Q41e-97AI5L5_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 5
TrEMBLA0A067L1G81e-120A0A067L1G8_JATCU; Uncharacterized protein
STRINGPOPTR_0002s12710.11e-114(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF19623481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G19290.26e-44ABRE binding factor 4